Cat. No.: DPP-001286
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Format | Liquid |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | PCSK1N |
UniProt No. | Q9UHG2 |
Gene ID | 27344 |
Molecular Weight | 27 kDa including tags |
Alternative Names | b-LEN; b-PEN-LEN; b-SAAS; Big LEN; granin like neuroendocrine peptide; l-LEN; l-SAAS; N-proSAAS; OTTHUMP00000032426; PCSK1_HUMAN; Pcsk1n; pro-SAAS; Proprotein convertase 1 inhibitor; Proprotein convertase subtilisin/kexin type 1 inhibitor; PROSAAS; SAAS; SAAS CT(1-49); SAAS CT(25-40) |
Function | May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known. |
Cellular Localization | Secreted. Golgi apparatus > trans-Golgi network. A N-terminal processed peptide, probably Big SAAS or Little SAAS, is accumulated in cytoplasmic protein tau deposits in frontotemporal dementia and parkinsonism linked to chromosome 17 (Pick disease), Alzheimer disease and amyotrophic lateral sclerosis-parkinsonism/dementia complex 1. |
Protein Length | Full length protein |
Sequence | MGSSHHHHHHSSGLVPRGSHMGSMARPVKEPRGLSAASPPLAETGAPRRF RRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQL LRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPV PAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADS EGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLP P |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.