Cat. No.: DPP-001074
Product Overview | |
---|---|
Species | Human |
Expression System | Wheat germ |
Format | Liquid |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | PYY |
UniProt No. | P10082 |
Gene ID | 5697 |
Molecular Weight | 37 kDa including tags |
Alternative Names | GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; Peptide YY(3-36); Prepro PYY; PYY; PYY 1; PYY II; PYY-I; PYY-II; PYY_HUMAN; PYY1; RATGHYY; Yy |
Function | This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. |
Cellular Localization | Secreted. |
Protein Length | Full length protein |
Sequence | MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW,Belongs to the NPY family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.