Recombinant Human Peptide YY/PYY Protein

Recombinant Human Peptide YY/PYY Protein

Cat. No.: DPP-001074

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name PYY
UniProt No. P10082
Gene ID 5697
Molecular Weight 37 kDa including tags
Alternative Names GHYY; MGC19143; Peptide tyrosine tyrosine; peptide YY; Peptide YY like; Peptide YY precursor; Peptide YY(3-36); Prepro PYY; PYY; PYY 1; PYY II; PYY-I; PYY-II; PYY_HUMAN; PYY1; RATGHYY; Yy
Function This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW,Belongs to the NPY family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Quick Links
Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top