x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001170
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | PDX1 |
| UniProt No. | P52945 |
| Gene ID | 3651 |
| Molecular Weight | 58 kDa including tags |
| Alternative Names | Glucose sensitive factor; Glucose-sensitive factor; GSF; IDX 1; IDX-1; IDX1; Insulin promoter factor 1; Insulin promoter factor 1 homeodomain transcription factor; Insulin upstream factor 1; IPF 1; IPF-1; IPF1; Islet/duodenum homeobox 1; Islet/duodenum homeobox-1; IUF 1; IUF-1; IUF1; MODY4; Pancreas/duodenum homeobox 1; Pancreas/duodenum homeobox protein 1; pancreatic and duodenal homeobox P; PDX 1; PDX-1; PDX1; PDX1_HUMAN; Somatostatin transactivating factor 1; Somatostatin-transactivating factor 1; STF 1; STF-1; STF1 |
| Function | Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell. |
| Involvement In Disease | Defects in PDX1 are a cause of pancreatic agenesis (PAC). This autosomal recessive disorder is characterized by absence or hypoplasia of pancreas, leading to early-onset insulin-dependent diabetes mellitus. This was found in a frameshift mutation that produces a truncated protein and results in a second initiation that produces a second protein that act as a dominant negative mutant.Defects in PDX1 are a cause of non-insulin-dependent diabetes mellitus (NIDDM); also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance.Defects in PDX1 are the cause of maturity-onset diabetes of the young type 4 (MODY4); also symbolized MODY-4. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Cellular Localization | Nucleus. |
| Protein Length | Full length protein |
| Sequence | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF PGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPF PEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPP AAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR,Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily. Contains 1 homeobox DNA-binding domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
