Cat. No.: DPP-001039
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥ 98% by HPLC |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | HCRTR2 |
| UniProt No. | O43614 |
| Gene ID | 3062 |
| Molecular Weight | 32 kDa including tags |
| Alternative Names | Hcr tr2; Hcrt receptor 2; Hcrtr2; Hypocretin (orexin) receptor 2; Hypocretin receptor 2; Hypocretin receptor type 2; Orexin 2 receptor; Orexin A/Orexin B receptor; Orexin receptor 2; Orexin receptor type 2; Orexin type 2 receptor; Ox-2-R; Ox2-R; Ox2r; OX2R_HUMAN; Type 2 hypocretin receptor; Type 2 orexin receptor |
| Function | Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. |
| Cellular Localization | Cell membrane. |
| Protein Length | Protein fragment |
| Sequence | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP KEYE,Belongs to the G-protein coupled receptor 1 family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
