x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001206
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Escherichia coli |
| Format | Liquid |
| Purity | ≥ 85% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | NEUROD1 |
| UniProt No. | Q13562 |
| Gene ID | 4760 |
| Molecular Weight | 40 kDa |
| Alternative Names | atonal; basic helix loop helix transcription factor; BETA 2; Beta cell E box transactivator 2; BETA2; BHF 1; BHF1; bHLHa3; class A basic helix loop helix protein 3; Class A basic helix-loop-helix protein 3; MODY 6; MODY6; NDF1_HUMAN; NeuroD; NeuroD1; Neurogenic differentiation 1; Neurogenic differentiation factor 1; neurogenic helix loop helix protein NEUROD; Neuronal differentiation 1 |
| Function | Differentiation factor required for dendrite morphogenesis and maintenance in the cerebellar cortex. Transcriptional activator. Binds to the insulin gene E-box. |
| Involvement In Disease | Defects in NEUROD1 are the cause of maturity-onset diabetes of the young type 6 (MODY6). MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Cellular Localization | Cytoplasm. Nucleus. |
| Protein Length | Full length protein |
| Sequence | TKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEED SLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKL RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIW ALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQ DMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSA ALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTM HYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLN AIFHDLEESGGGGSPGRRRRRRRRRRR,Contains 1 basic helix-loop-helix (bHLH) domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
