Cat. No.: DPP-001090
Product Overview | |
---|---|
Species | Human |
Expression System | Wheat germ |
Format | Liquid |
Purity | ≥ 70% by HPLC |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | IDE |
UniProt No. | P14735 |
Gene ID | 3416 |
Molecular Weight | 37 kDa including tags |
Alternative Names | Abeta-degrading protease; FLJ35968; Ide; IDE_HUMAN; Insulin protease; Insulin-degrading enzyme; Insulinase; Insulysin; OTTHUMP00000020097 |
Function | Plays a role in the cellular breakdown of insulin, IAPP, glucagon, bradykinin, kallidin and other peptides, and thereby plays a role in intercellular peptide signaling. Degrades amyloid formed by APP and IAPP. May play a role in the degradation and clearance of naturally secreted amyloid beta-protein by neurons and microglia. |
Cellular Localization | Cytoplasm. Cell surface. Present at the cell surface of neuron cells. The membrane-associated isoform is approximately 5 kDa larger than the known cytosolic isoform. |
Protein Length | Protein fragment |
Sequence | RDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVV GEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL,Belongs to the peptidase M16 family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.