Cat. No.: DPP-001058
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Endotoxin Level | < 0.100 Eu/µg |
Format | Lyophilized |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | IL6 |
UniProt No. | P05231 |
Gene ID | 3569 |
Molecular Weight | 22 kDa including tags |
Alternative Names | Interleukin BSF 2; B cell differentiation factor; B cell stimulatory factor 2; B-cell stimulatory factor 2; BSF 2; BSF-2; BSF2; CDF; CTL differentiation factor; Cytotoxic T cell differentiation factor; Hepatocyte stimulating factor; Hepatocyte stimulatory factor; HGF; HSF; Hybridoma growth factor; Hybridoma growth factor Interferon beta-2; Hybridoma plasmacytoma growth factor; IFN-beta-2; IFNB2; IL 6; IL-6; IL6; IL6_HUMAN; Interferon beta 2; Interferon beta-2; Interleukin 6; Interleukin 6 (interferon beta 2); Interleukin BSF 2; Interleukin-6 |
Function | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
Involvement In Disease | Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ). An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. |
Cellular Localization | Secreted. |
Protein Length | Full length protein |
Sequence | MKHHHHHHASVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRK ETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGL LEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM,Belongs to the IL-6 superfamily. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.