Cat. No.: DPP-001199
Product Overview | |
---|---|
Species | Human |
Expression System | HEK 293 cells |
Endotoxin Level | < 1.000 Eu/µg |
Format | Lyophilized |
Purity | ≥ 85% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | IL15RA |
UniProt No. | Q13261 |
Gene ID | 3601 |
Molecular Weight | 45 kDa including tags |
Alternative Names | AA690181; CD215; I15RA_HUMAN; IL 15R alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; Il15ra; Interleukin 15 receptor alpha; Interleukin 15 receptor subunit alpha; MGC104179; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA; Soluble interleukin 15 receptor subunit alpha; Soluble interleukin-15 receptor subunit alpha |
Function | Receptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 (By similarity) and SYK. |
Cellular Localization | Secreted > extracellular space; Membrane. Nucleus membrane. Mainly found associated with the nuclear membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle membrane. Membrane. Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. |
Protein Length | Protein fragment |
Sequence | MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYS LYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALV HQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGS QLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQG HSDTT,Contains 1 Sushi (CCP/SCR) domain. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.