Cat. No.: DPP-001143
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Format | Liquid |
Purity | ≥ 90% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | IL15 |
UniProt No. | P40933 |
Gene ID | 3600 |
Molecular Weight | 17 kDa including tags |
Alternative Names | IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721 |
Function | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. |
Cellular Localization | Secreted and Cytoplasm. Nucleus. IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components. |
Protein Length | Full length protein |
Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVI SLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS,Belongs to the IL-15/IL-21 family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.