Cat. No.: DPP-001128
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Format | Liquid |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | GCK |
UniProt No. | P35557 |
Gene ID | 2645 |
Molecular Weight | 53 kDa including tags |
Alternative Names | ATP:D-hexose 6-phosphotransferase; FGQTL3; GCK; GK; GLK; Glucokinase; Hexokinase D pancreatic isozyme; Hexokinase type IV; Hexokinase-4; Hexokinase-D; HHF3; HK IV; HK4; HKIV; HXK4_HUMAN; HXKP; LGLK; MODY2 |
Function | Catalyzes the initial step in utilization of glucose by the beta-cell and liver at physiological glucose concentration. Glucokinase has a high Km for glucose, and so it is effective only when glucose is abundant. The role of GCK is to provide G6P for the synthesis of glycogen. Pancreatic glucokinase plays an important role in modulating insulin secretion. Hepatic glucokinase helps to facilitate the uptake and conversion of glucose by acting as an insulin-sensitive determinant of hepatic glucose usage. |
Involvement In Disease | Defects in GCK are the cause of maturity-onset diabetes of the young type 2 (MODY2); also shortened MODY-2. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.Defects in GCK are the cause of familial hyperinsulinemic hypoglycemia type 3 (HHF3); also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur. |
Protein Length | Full length protein |
Sequence | MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETH EEASVKMLPT;YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQ WSVKTKHQMYSIPEDAMTGTAE;MLFDYISECISDFLDKHQMKHKKLPL GFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN;VVGLLRDAIKRRGD FEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQN;VE LVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKL IGGKYMGE;LVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVES DTGDRKQIYNILSTLGLRPS;TTDCDIVRRACESVSTRAAHMCSAGLAG VINRMRESRSEDVMRITVGVDGSVYKLHPSFK;ERFHASVRRLTPSCEI TFIESEEGSGRGAALVSAVACKKACMLGQ,Belongs to the hexokinase family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.