x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001099
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Escherichia coli |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | GAL |
| UniProt No. | P22466 |
| Gene ID | 51083 |
| Molecular Weight | 14 kDa including tags |
| Alternative Names | GAL; GAL 1; GAL GMAP; GAL1; GALA_HUMAN; Galanin message associated peptide; Galanin message-associated peptide; Galanin precursor; Galanin prepropeptide; Galanin related peptide; Galanin/GMAP prepropeptide; GALN; GLNN; GMAP; MGC40167 |
| Function | Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion. |
| Cellular Localization | Secreted. |
| Protein Length | Full length protein |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSASAGLWSPAKEKRGWTLNSAGYLLGPH AVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSF LHLKEAGALDRLLDLPAAASSEDIERS,Belongs to the galanin family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
