x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001264
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Baculovirus infected Sf9 cells |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | FTO |
| UniProt No. | Q9C0B1 |
| Gene ID | 79068 |
| Molecular Weight | 56 kDa |
| Alternative Names | AlkB homolog 9; ALKBH9; Alpha-ketoglutarate-dependent dioxygenase FTO; AW743446; Fat mass and obesity-associated protein; FATSO, MOUSE, HOMOLOG OF; Fto; FTO_HUMAN; GDFD; KIAA1752; mKIAA1752; Protein fatso |
| Function | Dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Has no activity towards 1-methylguanine. Has no detectable activity towards double-stranded DNA. Requires molecular oxygen, alpha-ketoglutarate and iron. Contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Contributes to the regulation of body size and body fat accumulation. |
| Involvement In Disease | Defects in FTO are the cause of growth retardation developmental delay coarse facies and early death (GRDDCFED). The disease consists of a severe children multiple congenital anomaly syndrome with death by the age of 3 years. All affected individuals had postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits, and characteristic facial dysmorphism. In some patients, structural brain malformations, cardiac defects, genital anomalies, and cleft palate were also observed. |
| Cellular Localization | Nucleus. |
| Protein Length | Protein fragment |
| Sequence | TPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRD LVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAE IAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGM GSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWH HDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIE TPGLAIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTL DYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQ FWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQR NEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDA SMPLPFDLTDIVSELRGQLLEAKP,Belongs to the fto family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
