x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001248
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | HEK 293 cells |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | FNDC5 |
| UniProt No. | Q8NAU1 |
| Gene ID | 252995 |
| Molecular Weight | 16 kDa |
| Alternative Names | Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin |
| Cellular Localization | Peroxisome membrane. Imported in peroxisomes through the PEX5 receptor pathway. |
| Protein Length | Full length protein |
| Sequence | DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQ EVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKM ASKNKDEVTMKE,Contains 1 fibronectin type-III domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
