x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001255
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | MUL1 |
| UniProt No. | Q969V5 |
| Gene ID | 79594 |
| Alternative Names | 0610009K11Rik; AV000801; C1orf166; Chromosome 1 open reading frame 166; E3 SUMO-protein ligase MUL1; E3 ubiquitin ligase; E3 ubiquitin protein ligase MUL1; E3 ubiquitin-protein ligase MUL1; FLJ12875; GIDE; Growth inhibition and death E3 ligase; MAPL; Mitochondrial anchored protein ligase; mitochondrial E3 ubiquitin ligase 1; mitochondrial E3 ubiquitin protein ligase 1; Mitochondrial ubiquitin ligase activator of NFKB 1; Mitochondrial-anchored protein ligase; MUL1; MUL1_HUMAN; MULAN; Putative NF kappa B activating protein 266; Putative NF-kappa-B-activating protein 266; RGD1309944; RING finger protein 218; RNF218; RP11-401M16.2; RP23-25C1.10-002 |
| Function | Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. |
| Cellular Localization | Mitochondrion outer membrane. Peroxisome. Transported in mitochondrion-derived vesicles from the mitochondrion to the peroxisome. |
| Protein Length | Full length protein |
| Sequence | MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGED LKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHK MVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDL GLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGE LVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFA TCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLY NS,Contains 1 RING-type zinc finger. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
