x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001271
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | MLXIPL |
| UniProt No. | Q9NP71 |
| Gene ID | 51085 |
| Alternative Names | carbohydrate response element binding protein; bHLHd14; Carbohydrate responsive element binding protein; Class D basic helix-loop-helix protein 14; MIO; MLX interacting protein like; Mlx interactor; MLX-interacting protein-like; MLXIPL; MONDOB; WBS14_HUMAN; WBSCR 14; WBSCR14; Williams Beuren syndrome chromosome region 14; Williams Beuren syndrome chromosome region 14 protein; Williams-Beuren syndrome chromosomal region 14 protein; WS basic helix loop helix leucine zipper protein; WS basic-helix-loop-helix leucine zipper protein; WS bHLH; WS-bHLH |
| Function | Transcriptional repressor. Binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'. |
| Involvement In Disease | WBSCR14 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR14 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. |
| Cellular Localization | Nucleus. |
| Protein Length | Protein fragment |
| Sequence | PPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRI THISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI,Contains 1 basic helix-loop-helix (bHLH) domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
