x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001115
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥ 95% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | CERS1 |
| UniProt No. | P27544 |
| Gene ID | 10715 |
| Alternative Names | Ceramide synthase 1; CerS1; CERS1_HUMAN; LAG1; LAG1 homolog ceramide synthase 1; LAG1 longevity assurance homolog 1; LASS 1; LASS1; Longevity assurance (LAG1 S. cerevisiae) homolog 1; Longevity assurance gene 1; Longevity assurance gene 1 protein homolog 1; MGC90349; Protein LAG1; Protein UOG 1; Protein UOG-1; UOG 1 protein; UOG1; Upstream of GDF1 |
| Function | May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner. |
| Cellular Localization | Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Isoform 1 may recycle from the Golgi to the endoplasmic reticulum. |
| Protein Length | Protein fragment |
| Sequence | YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF,Contains 1 TLC (TRAM/LAG1/CLN8) domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
