Cat. No.: DPP-001274
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Endotoxin Level | < 1.000 Eu/µg |
Format | Lyophilized |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | CCL28 |
UniProt No. | Q9NRJ3 |
Gene ID | 56477 |
Molecular Weight | 12 kDa |
Alternative Names | C C motif chemokine ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK 1; CCK1; CCK1 protein; CCL 28; CCL28; CCL28_HUMAN; Chemokine (C-C motif) ligand 28; chemokine (C-C motif) ligand 28 splice variant chi; MEC; Mucosae associated epithelial chemokine; Mucosae-associated epithelial chemokine; Protein CCK1; SCYA28; Small inducible cytokine A28 [Precursor]; small inducible cytokine subfamily A (Cys-Cys), member 28; Small-inducible cytokine A28 |
Function | Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. |
Cellular Localization | Secreted. |
Protein Length | Full length protein |
Sequence | SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKR RRICVSPHNHTVKQWMKVQAAKKNGKGNVC HRKKHHGKRNSNRAHQGKHETYGHKTPY,Belongs to the intercrine beta (chemokine CC) family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.