x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001126
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | CCKBR |
| UniProt No. | P32239 |
| Gene ID | 887 |
| Molecular Weight | 38 kDa including tags |
| Alternative Names | CCK B; CCK B receptor; CCK BR; CCK-B receptor; CCK-BR; CCK2 R; CCK2 receptor; CCK2-R; CCKB; CCKB receptor; CCKBR; CCKR Type B; CCKRB; Cholecystokinin 2 receptor; Cholecystokinin B receptor; Cholecystokinin-2 receptor; Cholecystokinin2 receptor; CholecystokininB receptor; GASR; GASR_HUMAN; Gastrin receptor; Gastrin/cholecystokinin type B receptor; Gastrin\cholecystokinin brain receptor |
| Function | Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism. |
| Cellular Localization | Cell membrane. |
| Protein Length | Protein fragment |
| Sequence | RQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVR NQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGP GSGSRPTQAKLLA,Belongs to the G-protein coupled receptor 1 family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
