Cat. No.: DPP-001105
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Endotoxin Level | < 0.050 Eu/µg |
Format | Lyophilized |
Purity | ≥ 98% |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | BDNF |
UniProt No. | P23560 |
Gene ID | 627 |
Molecular Weight | 27 kDa including tags |
Alternative Names | Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin |
Function | During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. |
Involvement In Disease | Bulimia nervosa 2, Congenital central hypoventilation syndrome |
Cellular Localization | Secreted. |
Protein Length | Full length protein |
Sequence | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR,Belongs to the NGF-beta family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.