x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001207
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥ 90% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | LRP8 |
| UniProt No. | Q14114 |
| Gene ID | 7804 |
| Molecular Weight | 35 kDa including tags |
| Alternative Names | APOER2; Apolipoprotein E receptor 2; low density lipoprotein receptor-related protein 8; Low-density lipoprotein receptor-related protein 8; LRP-8; LRP8; LRP8_HUMAN |
| Function | Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. May also function as an endocytic receptor. |
| Involvement In Disease | Defects in LRP8 are a cause of myocardial infarction type 1 (MCI1). A condition defined by the irreversible necrosis of heart muscle secondary to prolonged ischemia. |
| Cellular Localization | Cell membrane. Secreted. Isoforms that contain the exon coding for a furin-type cleavage site are proteolytically processed, leading to a secreted receptor fragment. |
| Protein Length | Protein fragment |
| Sequence | KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKL SCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH,Belongs to the LDLR family. Contains 2 EGF-like domains. Contains 7 LDL-receptor class A domains. Contains 5 LDL-receptor class B repeats. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
