Recombinant Human AGRP Protein (His tag)

Recombinant Human AGRP Protein (His tag)

Cat. No.: DPP-001028

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Liquid
Purity ≥ 98% by NMR
Nature Recombinant
Target Information
Gene Name AGRP
UniProt No. O00253
Gene ID 181
Molecular Weight 15 kDa including tags
Alternative Names Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2
Function Plays a role in weight homeostasis. Plays a role in the central control of feeding. Reduces food intake. Inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Acts primarily on MC3R and MC4R. Has very low activity with MC5R.
Involvement In Disease Genetic variations in AGRP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
Cellular Localization Secreted. Golgi apparatus lumen.
Protein Length Full length protein
Sequence MGSSHHHHHHSSGLVPRGSHMGSHMAQMGLAPMEGIRRPDQALLPELPGL GLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCL GQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT,Contains 1 agouti domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Quick Links
Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top