Recombinant Human Adiponectin Protein (Fc Chimera)

Recombinant Human Adiponectin Protein (Fc Chimera)

Cat. No.: DPP-001219

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System HEK 293 cells
Endotoxin Level < 1.000 Eu/µg
Format Lyophilized
Purity ≥ 95% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name ADIPOQ
UniProt No. Q15848
Gene ID 9370
Molecular Weight 51 kDa including tags
Alternative Names 30 kDa adipocyte complement related protein; 30 kDa adipocyte complement-related protein; ACDC; Acrp 30; ACRP30; ADIPO_HUMAN; Adipocyte; Adipocyte C1q and collagen domain containing protein; Adipocyte complement related 30 kDa protein; Adipocyte complement related protein of 30 kDa; Adipocyte complement-related 30 kDa protein; adipocyte-specific secretory protein; Adiponectin; Adiponectin precursor; adiponectin, C1Q and collagen domain containing; Adipoq; Adipose most abundant gene transcript 1; Adipose most abundant gene transcript 1 protein; Adipose specific collagen like factor; ADIPQTL1; ADPN; APM 1; apM-1; APM1; C1q and collagen domain-containing protein; GBP 28; GBP28; Gelatin binding protein; Gelatin binding protein 28; Gelatin-binding protein; gelatin-binding protein 28; OTTHUMP00000210047
Function Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Involvement In Disease Defects in ADIPOQ are the cause of adiponectin deficiency (ADPND). ADPND results in very low concentrations of plasma adiponectin.Genetic variations in ADIPOQ are associated with non-insulin-dependent diabetes mellitus (NIDDM); also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEK GDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVG LETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYM KDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGE GERNGLYADNDNDSTFTGFLLYHDTN,Contains 1 C1q domain. Contains 1 collagen-like domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Quick Links
Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top