x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001117
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥ 98% by HPLC |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | HTR2C |
| UniProt No. | P28335 |
| Gene ID | 3358 |
| Molecular Weight | 31 kDa including tags |
| Alternative Names | 5 Hydroxytryptamine 2C receptor; 5-HT-1C; 5-ht-1c receptor; 5-HT-2C; 5-HT1C; 5-HT2C; 5-HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled; 5-hydroxytryptamine receptor 1C; 5-hydroxytryptamine receptor 2C; 5HT1C; 5HT2C; 5HT2C_HUMAN; 5HTR2C; 5Hydroxytryptamine 2C receptor; Htr1c; HTR2C; serotonin 1c receptor; serotonin 2c receptor; Serotonin 5-HT-2C receptor; Serotonin receptor 2C |
| Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. |
| Cellular Localization | Cell membrane. |
| Protein Length | Protein fragment |
| Sequence | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPD GV,Belongs to the G-protein coupled receptor 1 family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
