Cat. No.: DPP-001205
Product Overview | |
---|---|
Species | Human |
Expression System | Escherichia coli |
Endotoxin Level | < 1.000 Eu/µg |
Format | Lyophilized |
Purity | ≥ 90% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | EIF4EBP2 |
UniProt No. | Q13542 |
Gene ID | 1979 |
Molecular Weight | 12 kDa |
Alternative Names | 4E-BP2; 4EBP2; 4EBP2_HUMAN; eIF4E binding protein 2; eIF4E-binding protein 2; Eif4ebp2; Eukaryotic translation initiation factor 4E binding protein 1; Eukaryotic translation initiation factor 4E-binding protein 2; PHASII; phosphorylated, heat and acid stable regulated by insulin protein II |
Function | Repressor of translation initiation involved in synaptic plasticity, learning and memory formation (By similarity). Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation (By similarity). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. |
Protein Length | Full length protein |
Sequence | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGT RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNN LNNHDRKHAVGDDAQFEMDI,Belongs to the eIF4E-binding protein family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.