x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001234
| Product Overview | |
|---|---|
| Species | Human, Mouse, Rat |
| Format | Lyophilized |
| Purity | ≥95% by SDS-PAGE |
| Target Information | |
|---|---|
| UniProt No. | Q6UWT2; Q8K1D8; A0A1S3G1X3 |
| Molecular Formula | C190H295N55O68S2 |
| Molecular Weight | 4501.88 |
| Function | Adropin is a secreted hormone that regulates lipid and glucose metabolism. It is mainly expressed in brain and liver and is encoded by the energy homeostasis associated gene. It has been shown that adropin has beneficial effect in obesity animal models. |
| Sequence | CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP-OH |
| Sequence | Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
