x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001319
| Product Overview | |
|---|---|
| Species | Human |
| Format | Lyophilized |
| Purity | ≥ 97% by SDS-PAGE |
| Target Information | |
|---|---|
| Molecular Formula | C187H275N47O53 |
| Molecular Weight | 4029.52 |
| Function | Preptin is a 34 amino acid peptide hormone that is produced from Asp(69)-Leu(102) of pro-IGF-II and is secreted by pancreatic β-cells. Preptin has been located in mammary tissue, the pancreas, and kidneys. High plasma concentrations of preptin was associated with obesity. |
| Sequence | DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL-OH |
| Sequence | Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
