x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001313
| Product Overview | |
|---|---|
| Species | Human |
| Format | Lyophilized |
| Purity | ≥ 90% by SDS-PAGE |
| Target Information | |
|---|---|
| Molecular Formula | C171H266N48O56S |
| Molecular Weight | 3922.4 |
| Function | Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily. |
| Sequence | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| Sequence | H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
