Cat. No.: DPP-001301
Product Overview | |
---|---|
Species | Gila |
Format | Lyophilized |
Purity | ≥97% by SDS-PAGE |
Target Information | |
---|---|
Molecular Formula | C169H262N44O54S |
Molecular Weight | 3806.5 |
Function | This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1–stimulated insulin release after food intake. |
Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Sequence | H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.