Urotensin I TFA

Cat. No: CDIA-1220

Synonyms: Catostomus urotensin I TFA

Size: 50 mg

Price: Inquiry

Product Details
Formula	C212H341F3N62O69S2
Molecular Weight	4983.48
Appearance	Solid
Purity	98.29%
Sequence	Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence Shortening	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.

! For research use only. Not intended for any clinical use.