Urotensin I

Cat. No: CDIA-1147

CAS. No.: 83930-33-0

Synonyms: Catostomus urotensin I

Size: 50 mg

Price: Inquiry

Product Details
Formula	C210H340N62O67S2
Molecular Weight	4869.46
Sequence	Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence Shortening	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.

! For research use only. Not intended for any clinical use.