Urocortin III, (mouse) TFA

Cat. No: CDIA-0896

Size: 5 mg

Price: Inquiry

Product Details
Formula	C188H313N52F3O54S2
Molecular Weight	4286.99
Appearance	Solid
Purity	99.56%
Sequence	Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Sequence Shortening	FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.

! For research use only. Not intended for any clinical use.