Urocortin III, (mouse)

Cat. No: CDIA-1581

CAS. No.: 357952-10-4

Size: 50 mg

Price: Inquiry

Product Details
Formula	C186H312N52O52S2
Molecular Weight	4172.97
Sequence	Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Sequence Shortening	FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.

! For research use only. Not intended for any clinical use.