Proadrenomedullin (45-92), (human)

Cat. No: CDIA-1580

CAS. No.: 166798-69-2

Size: 50 mg

Price: Inquiry

Product Details
Formula	C215H359N67O73S2
Molecular Weight	5114.76
Sequence	Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val
Sequence Shortening	ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.

! For research use only. Not intended for any clinical use.