Prepro VIP (81-122), (human)

Cat. No: CDIA-1588

CAS. No.: 111366-38-2

Size: 50 mg

Price: Inquiry

Product Details
Formula	C202H325N53O64S
Molecular Weight	4552.13
Sequence	His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val
Sequence Shortening	HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.

! For research use only. Not intended for any clinical use.