PHM-27, (human)

Cat. No: CDIA-1524

CAS. No.: 87403-73-4

Size: 50 mg

Price: Inquiry

Product Details
Formula	C135H214N34O40S
Molecular Weight	2985.41
Sequence	{His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2
Sequence Shortening	HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.

! For research use only. Not intended for any clinical use.