Parstatin, (human)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Parstatin, (human)

Cat. No: CDIA-1533
CAS. No.: 1065755-99-8
Size: 50 mg
Price: Inquiry
Product Details
Formula C191H330N64O53S3
Molecular Weight 4467.26
Sequence Shortening MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Storage & Handling
Shipping Room temperature.
Storage Please refer to the instruction manual.

Description

Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis.

! For research use only. Not intended for any clinical use.