Endothelin-1 (1-31), (human)

Cat. No: CDIA-1608

CAS. No.: 133972-52-8

Size: 50 mg

Price: Inquiry

Product Details
Formula	C162H236N38O47S5
Molecular Weight	3628.16
Sequence	Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)
Sequence Shortening	CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase.

! For research use only. Not intended for any clinical use.