ELA-32, (human)

Cat. No: CDIA-1573

CAS. No.: 1680205-79-1

Size: 50 mg

Price: Inquiry

Product Details
Formula	C170H289N63O39S4
Molecular Weight	3967.82
Sequence Shortening	QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

ELA-32 (human) is a potent critical cardiac developmental peptide that acts through the G-protein–coupled apelin receptor.

! For research use only. Not intended for any clinical use.