Defensin HNP-1, (human) TFA

Cat. No: CDIA-1205

Size: 50 mg

Price: Inquiry

Product Details
Formula	C152H229F3N44O40S6
Molecular Weight	3556.05
Appearance	Solid
Purity	98.16%
Sequence Shortening	ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities.

! For research use only. Not intended for any clinical use.