Defensin HNP-1, (human)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Defensin HNP-1, (human)

Cat. No: CDIA-1572
CAS. No.: 99287-08-8
Size: 50 mg
Price: Inquiry
Product Details
Formula C150H228N44O38S6
Molecular Weight 3442.03
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys
Sequence Shortening ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Storage & Handling
Shipping Room temperature.
Storage Please refer to the instruction manual.

Description

Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities.

! For research use only. Not intended for any clinical use.