β-CGRP, (human) TFA

Cat. No: CDIA-0350

Synonyms: Human β-CGRP TFA; CGRP-II (human) (TFA)

Size: 1 mg

Price: Inquiry

Product Details
Formula	C164H268F3N51O50S3
Molecular Weight	3907.38
Appearance	Solid
Purity	99.10%
Sequence	Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)
Sequence Shortening	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

! For research use only. Not intended for any clinical use.