β-CGRP, (human)

Cat. No: CDIA-1159

CAS. No.: 101462-82-2

Synonyms: Human β-CGRP; CGRP-II (human)

Size: 50 mg

Price: Inquiry

Product Details
Formula	C162H267N51O48S3
Molecular Weight	3793.41
Sequence	Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)
Sequence Shortening	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

! For research use only. Not intended for any clinical use.