Online Inquiry
β-CGRP, (human)
Cat. No: CDIA-1159
CAS. No.: 101462-82-2
Synonyms: Human β-CGRP; CGRP-II (human)
Size: 50 mg
Price: Inquiry

Product Details | |
---|---|
Formula | C162H267N51O48S3 |
Molecular Weight | 3793.41 |
Sequence | Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7) |
Sequence Shortening | ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7) |
Storage & Handling | |
---|---|
Shipping | Room temperature. |
Storage | Please refer to the instruction manual. |
Description
! For research use only. Not intended for any clinical use.