C-type natriuretic peptide (1-53), (human)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

C-type natriuretic peptide (1-53), (human)

Cat. No: CDIA-1599
CAS. No.: 141294-77-1
Size: 50 mg
Price: Inquiry
Product Details
Formula C251H417N81O71S3
Molecular Weight 5801.77
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys37-Cys55)
Sequence Shortening DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
Storage & Handling
Shipping Room temperature.
Storage Please refer to the instruction manual.

Description

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

! For research use only. Not intended for any clinical use.