Brain natriuretic peptide (1-32), (rat)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Brain natriuretic peptide (1-32), (rat)

Cat. No: CDIA-1594
CAS. No.: 133448-20-1
Synonyms: BNP (1-32), rat
Size: 50 mg
Price: Inquiry
Product Details
Formula C146H239N47O44S3
Molecular Weight 3452.94
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
Sequence Shortening NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
Storage & Handling
Shipping Room temperature.
Storage Please refer to the instruction manual.

Description

Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

! For research use only. Not intended for any clinical use.