Brain natriuretic peptide (1-32), rat acetate

Cat. No: CDIA-0828

Synonyms: BNP (1-32), rat acetate

Size: 5 mg

Price: Inquiry

Product Details
Formula	C148H243N47O46S3
Molecular Weight	3512.99
Appearance	Solid
Purity	99.02%
Sequence	Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
Sequence Shortening	NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

! For research use only. Not intended for any clinical use.