BeKm-1

Cat. No: CDIA-1086

CAS. No.: 524962-01-4

Size: 5 mg

Price: Inquiry

Product Details
Formula	C174H261N51O52S6
Molecular Weight	4091.65
Sequence Shortening	RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

BeKm-1 is a HERG (human ether-a-go-go-related gene) blocking compound. BeKm-1 can be used for the research of heart disease.

! For research use only. Not intended for any clinical use.