Apelin-36 (rat, mouse) TFA

Product Details
Formula	C187H305F3N68O45S
Molecular Weight	4314.91
Sequence	Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

! For research use only. Not intended for any clinical use.