Apelin-36, (human) TFA

Cat. No: CDIA-2131

Size: 5 mg

Price: Inquiry

Product Details
Formula	C186H298F3N69O45S
Molecular Weight	4309.85
Sequence	Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ.

! For research use only. Not intended for any clinical use.