Apelin-36, (human)

Cat. No: CDIA-0928

CAS. No.: 252642-12-9

Size: 5 mg

Price: Inquiry

Product Details
Formula	C184H297N69O43S
Molecular Weight	4195.83
Appearance	Solid
Purity	98.11%
Sequence	Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture and light, under nitrogen *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ.

! For research use only. Not intended for any clinical use.