Adrenotensin, (human)
Online Inquiry
* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Adrenotensin, (human)

Cat. No: CDIA-1639
CAS. No.: 166546-72-1
Synonyms: Pro-ADM-153-185 (human)
Size: 50 mg
Price: Inquiry
Product Details
Formula C143H224N42O43
Molecular Weight 3219.56
Sequence Shortening SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Storage & Handling
Shipping Room temperature.
Storage Please refer to the instruction manual.

Description

Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.

! For research use only. Not intended for any clinical use.